PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G297800.1.p
Common NameSb02g032860, SORBIDRAFT_02g032860
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRF
Protein Properties Length: 272aa    MW: 28314.4 Da    PI: 4.7299
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G297800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC71.41e-22182225144
                   WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                           ++epgrCrRtDGKkWRC+r +++++k+CErH+hrgr+r  + ++
  Sobic.002G297800.1.p 182 EPEPGRCRRTDGKKWRCWRSTIPNEKYCERHMHRGRKRPVQVVV 225
                           69************************************887665 PP

2QLQ53.29e-19116151237
                   QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                           aFTa+Qlq+L++Q  +y+y+aa++PvP +L+++++k
  Sobic.002G297800.1.p 116 AFTAMQLQELEQQSRVYQYMAARVPVPTHLVFPVWK 151
                           8*********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.0E-7115151IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.524116151IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.2E-11116150IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166722.455182226IPR014977WRC domain
PfamPF088792.8E-19183220IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MAAEGEGKNP AGGGGGDNPQ HQQAVQAAPA PAAQGEAAQE AGGQGTGLEP EGEKADREGE  60
GGGAGEKDDA ACRDLVLVED PEVVAVEDPE EAAATAALQE EMKALVASIP DGAGAAFTAM  120
QLQELEQQSR VYQYMAARVP VPTHLVFPVW KSVTGASSEG AQKYPTLMGL ATLCLDFGKN  180
PEPEPGRCRR TDGKKWRCWR STIPNEKYCE RHMHRGRKRP VQVVVEDDEP DSASGSKSTP  240
GKATDGAKKA DDKSPSSKKL AVAAPAAVQS T*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.136190.0callus| ovary
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0425130.0BT042513.1 Zea mays full-length cDNA clone ZM_BFb0310G14 mRNA, complete cds.
GenBankBT0874370.0BT087437.1 Zea mays full-length cDNA clone ZM_BFb0076N13 mRNA, complete cds.
GenBankEF5158490.0EF515849.1 Zea mays putative growth-regulating factor 10 (GRF10) mRNA, complete cds.
GenBankEU9606010.0EU960601.1 Zea mays clone 226522 growth-regulating factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002462840.10.0hypothetical protein SORBIDRAFT_02g032860
SwissprotQ6AWX81e-130GRF11_ORYSJ; Growth-regulating factor 11
TrEMBLC5X8F10.0C5X8F1_SORBI; Putative uncharacterized protein Sb02g032860
STRINGSb02g032860.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67353152
Representative plantOGRP1193646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.17e-30growth-regulating factor 5